A7954
ARHGEF11 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7954
- Additional Names:
- ARHGEF11|GTRAP48|PDZ-RHOGEF
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 168kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNS
- Uniprot:
- O15085
- Synonyms:
- glutamate transporter EAAT4-associated protein 48;GTRAP48;PDZ-RHOGEF;Rho guanine exchange factor (GEF) 11;Rho guanine nucleotide exchange factor (GEF) 11;rho guanine nucleotide exchange factor 11;RhoA-specific guanine nucleotide exchange factor;RhoGEF glutamate transport modulator
- Extra Details:
- Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice