WHSC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7938
Additional Names:: KMT3F|KMT3G|MMSET|RAUST|REIIBP|TRX5|WHS|WHSC1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 80 kDa/152 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
Uniprot:: O96028
Synonyms:: histone-lysine N-methyltransferase NSD2;IL5 promoter REII region-binding protein;KMT3F;KMT3G;MMSET;multiple myeloma SET domain containing protein type III;Multiple myeloma SET domain-containing protein;nuclear SET domain-containing protein 2;probable histone-lysine N-methyltransferase NSD2;Protein trithorax-5;REIIBP;trithorax/ash1-related protein 5;TRX5;WHS;WHSC1;Wolf-Hirschhorn syndrome candidate 1;Wolf-Hirschhorn syndrome candidate 1 protein
Extra Details:: This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences.

Shipping Conditions:: Blue Ice