A7936
TFE3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7936
- Additional Names:
- bHLHe33|MRXSPF|RCCP2|RCCX1|TFE3|TFEA
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQPLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAG
- Uniprot:
- P19532
- Synonyms:
- bHLHe33;class E basic helix-loop-helix protein 33;RCCP2;RCCX1;TFEA;transcription factor E family, member A;transcription factor E3;transcription factor for IgH enhancer;transcription factor for immunoglobulin heavy-chain enhancer 3
- Extra Details:
- This gene encodes a basic helix-loop-helix domain-containing transcription factor that binds MUE3-type E-box sequences in the promoter of genes. The encoded protein promotes the expression of genes downstream of transforming growth factor beta (TGF-beta) signaling. This gene may be involved in chromosomal translocations in renal cell carcinomas and other cancers, resulting in the production of fusion proteins. Translocation partners include PRCC (papillary renal cell carcinoma), NONO (non-POU domain containing, octamer-binding), and ASPSCR1 (alveolar soft part sarcoma chromosome region, candidate 1), among other genes. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

