A7935
TFAP2B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7935
- Additional Names:
- AP-2B|AP-2beta|AP2-B|PDA2|TFAP2B
- Application:
- ELISA, WB
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQ
- Uniprot:
- Q92481
- Synonyms:
- activating enhancer binding protein 2 beta;Activating enhancer-binding protein 2-beta;AP-2B;AP-2beta;AP2-B;AP2-beta;PDA2;transcription factor AP-2-beta
- Extra Details:
- This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives.
- Shipping Conditions:
- Blue Ice