A7919
PLOD1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7919
- Additional Names:
- EDS6|EDSKCL1|LH|LH1|LLH|PLOD|PLOD1
- Application:
- ELISA, WB
- Molecular Weight:
- 84kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGLGEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELLKKFRQARSQVVFSAEELIYPDRRLETKYPVVSDGKRFLGSGGFIGYAPNLSKLVAEWEGQDSDSDQLFYTKIFLDPEKREQINITLDHRCRIFQNLDGALDEVVLKFEMGHVRARNLAYDTLPVLIHGNGPTKLQLNYLGNYIPRFWTFETGCTVCDEGLRSLKGIGDEALPTVLVGVFIE
- Uniprot:
- Q02809
- Synonyms:
- EDS6;EDSKCL1;LH;LH1;LLH;lysine hydroxylase;lysyl hydroxlase 1;Lysyl hydroxylase 1;PLOD;procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1;procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
- Extra Details:
- Lysyl hydroxylase is a membrane-bound homodimeric protein localized to the cisternae of the endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VI have deficiencies in lysyl hydroxylase activity. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice