A7906
KCNS3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7906
- Additional Names:
- KCNS3|KV9.3
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 56kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAY
- Uniprot:
- Q9BQ31
- Synonyms:
- delayed-rectifier K(+) channel alpha subunit 3;KV9.3;potassium voltage-gated channel delayed-rectifier protein S3;potassium voltage-gated channel subfamily S member 3;potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3;Shab-related delayed-rectifier K+ channel alpha subunit 3;voltage-gated potassium channel protein Kv9.3;voltage-gated potassium channel subunit Kv9.3
- Extra Details:
- Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
- Shipping Conditions:
- Blue Ice





_IHC_02.jpg)
_IHC_01.jpg)
_IHC_03.jpg)