A7904
ING1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7904
- Additional Names:
- ING1|p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a
- Application:
- ELISA, WB
- Molecular Weight:
- 47kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAWRVSPLPLSPLSPATFGRGFIAVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRGWGRAWPWKQILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQ
- Uniprot:
- Q9UK53
- Synonyms:
- growth inhibitor ING1;growth inhibitory protein ING1;inhibitor of growth protein 1;p24ING1c;p33;p33ING1;p33ING1b;p47;p47ING1a;tumor suppressor ING1
- Extra Details:
- This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Shipping Conditions:
- Blue Ice

