A7898
GTF2I Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7898
- Additional Names:
- BAP135|BTKAP1|DIWS|GTF2I|GTFII-I|IB291|SPIN|TFII-I|WBS|WBSCR6
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 132kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FESNPEFLYVEGLPEGIPFRSPTWFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASKINTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSAVRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEM
- Uniprot:
- P78347
- Synonyms:
- BAP135;Bruton tyrosine kinase-associated protein 135;BTK-associated protein, 135kD;BTKAP1;DIWS;general transcription factor II-I;GTFII-I;IB291;SPIN;SRF-Phox1-interacting protein;TFII-I;WBS;WBSCR6;Williams-Beuren syndrome chromosomal region 6 protein;Williams-Beuren syndrome chromosome region 6
- Extra Details:
- This gene encodes a phosphoprotein containing six characteristic repeat motifs. The encoded protein binds to the initiator element (Inr) and E-box element in promoters and functions as a regulator of transcription. This locus, along with several other neighboring genes, is deleted in Williams-Beuren syndrome. There are many closely related genes and pseudogenes for this gene on chromosome 7. This gene also has pseudogenes on chromosomes 9, 13, and 21. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
- Shipping Conditions:
- Blue Ice