PSD95 Rabbit PolymAb[R]

Size

POA

SKU:: A7889PM
Additional Names:: MRD62|PSD95|SAP-90|SAP90
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 95 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKII
Uniprot:: P78352
Synonyms:: discs large homolog 4;disks large homolog 4;MRD62;post-synaptic density protein 95;Postsynaptic density protein 95;PSD95;SAP-90;SAP90;synapse-associated protein 90;Tax interaction protein 15
Extra Details:: This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.