A7886
Clathrin heavy chain Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7886
- Additional Names:
- CHC|CHC17|Clathrin heavy chain|CLH-17|CLTCL2|Hc|MRD56
- Application:
- ELISA, WB
- Molecular Weight:
- 180kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVP
- Uniprot:
- Q00610
- Synonyms:
- CHC;CHC17;clathrin heavy chain 1;clathrin heavy chain on chromosome 17;clathrin, heavy polypeptide (Hc);clathrin, heavy polypeptide-like 2;CLH-17;CLTCL2;Hc;MRD56
- Extra Details:
- Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.
- Shipping Conditions:
- Blue Ice