[KO Validated] CHD1 Rabbit polyclonal antibody

Size

POA

SKU:: A7883
Additional Names:: CHD-1|D1|PILBOS
Application:: ELISA, WB, IHC-P
Molecular Weight:: 250kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DREKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT
Uniprot:: O14646
Synonyms:: ATP-dependent helicase CHD1;CHD-1;chromodomain-helicase-DNA-binding protein 1;PILBOS
Extra Details:: The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.