A7876
AMPD1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7876
- Additional Names:
- AMPD1|MAD|MADA|MMDD
- Application:
- ELISA, WB
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MNVRIFYSVSQSPHSLLSLLFYCAILESRISATMPLFKLPAEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTS
- Uniprot:
- P23109
- Synonyms:
- adenosine monophosphate deaminase 1 (isoform M);adenosine monophosphate deaminase-1 (muscle);AMP deaminase 1;AMP deaminase isoform M;AMPD;MAD;MADA;MMDD;myoadenylate deaminase;skeletal muscle AMPD
- Extra Details:
- Adenosine monophosphate deaminase 1 catalyzes the deamination of AMP to IMP in skeletal muscle and plays an important role in the purine nucleotide cycle. Two other genes have been identified, AMPD2 and AMPD3, for the liver- and erythocyte-specific isoforms, respectively. Deficiency of the muscle-specific enzyme is apparently a common cause of exercise-induced myopathy and probably the most common cause of metabolic myopathy in the human. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
- Shipping Conditions:
- Blue Ice

