A7857
TMEM184A Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7857
- Additional Names:
- SDMG1|TMEM184A
- Application:
- ELISA, WB
- Molecular Weight:
- 46kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL
- Uniprot:
- Q6ZMB5
- Synonyms:
- SDMG1;sexually dimorphic, expressed in male gonads 1;transmembrane protein 184A
- Extra Details:
- Predicted to enable heparin binding activity. Predicted to act upstream of or within germ-line sex determination; regulation of protein localization; and regulation of secretion. Predicted to be located in cytoplasmic vesicle; perinuclear region of cytoplasm; and plasma membrane. Predicted to be active in early endosome membrane. Predicted to be integral component of membrane.
- Shipping Conditions:
- Blue Ice