SLC22A11 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7816
Additional Names:: hOAT4|OAT4|SLC22A11
Application:: ELISA, WB
Molecular Weight:: 65 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQG
Uniprot:: Q9NSA0
Synonyms:: hOAT4;OAT4;organic anion transporter 4;solute carrier family 22 (organic anion/cation transporter), member 11;solute carrier family 22 (organic anion/urate transporter), member 11;solute carrier family 22 member 11
Extra Details:: The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Alternative splicing results in multiple transcript variants.