A7811
RBFOX1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7811
- Additional Names:
- 2BP1|A2BP1|FOX-1|FOX1|HRNBP1|RBFOX1
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 45-50 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENT
- Uniprot:
- Q9NWB1
- Synonyms:
- 2BP1;A2BP1;ataxin 2-binding protein 1;Ataxin-2-binding protein 1;FOX-1;fox-1 homolog A;fox-1-like RNA-binding protein 1;FOX1;hexaribonucleotide-binding protein 1;HRNBP1;RNA binding protein fox-1 homolog 1;RNA binding protein, fox-1 homolog 1
- Extra Details:
- The Fox-1 family of RNA-binding proteins is evolutionarily conserved, and regulates tissue-specific alternative splicing in metazoa. Fox-1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. Fox-1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice