RASGRP3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7791
Additional Names:: GRP3|RASGRP3
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 78kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
Uniprot:: Q8IV61
Synonyms:: calcium and DAG-regulated guanine nucleotide exchange factor III;calcium- and diacylglycerol-regulated guanine nucleotide exchange factor III;CalDAG-GEFIII;GRP3;guanine nucleotide exchange factor for Rap1;RAS guanyl releasing protein 3 (calcium and DAG-regulated);ras guanyl-releasing protein 3
Extra Details:: The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers.