A7789
CBLC Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7789
- Additional Names:
- CBL-3|CBL-SL|CBLC|RNF57
- Application:
- ELISA, WB
- Molecular Weight:
- 52kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
- Uniprot:
- Q9ULV8
- Synonyms:
- Cas-Br-M (murine) ecotropic retroviral transforming sequence c;Cas-Br-M (murine) ectropic retroviral transforming sequence c;Cbl proto-oncogene C, E3 ubiquitin protein ligase;Cbl proto-oncogene, E3 ubiquitin protein ligase C;CBL-3;CBL-SL;E3 ubiquitin-protein ligase CBL-C;RING finger protein 57;RING-type E3 ubiquitin transferase CBL-C;RNF57;SH3-binding protein CBL-3;SH3-binding protein CBL-C;signal transduction protein CBL-C
- Extra Details:
- This gene encodes a member of the Cbl family of E3 ubiquitin ligases. Cbl proteins play important roles in cell signaling through the ubiquitination and subsequent downregulation of tyrosine kinases. Expression of this gene may be restricted to epithelial cells, and alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice

