NAT8 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7759
Additional Names:: ATase2|CCNAT|CML1|GLA|Hcml1|NAT8|TSC501|TSC510
Application:: ELISA, WB, IHC-P
Molecular Weight:: 26kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLP
Uniprot:: Q9UHE5
Synonyms:: acetyltransferase 2;ATase2;camello-like protein 1;CCNAT;CML1;cysteinyl-conjugate N-acetyltransferase;GLA;Hcml1;kidney- and liver-specific gene product;N-acetyltransferase 8;N-acetyltransferase 8 (camello like);N-acetyltransferase 8 (GCN5-related, putative);probable N-acetyltransferase 8;TSC501;TSC510
Extra Details:: This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene.