A7751
TTF2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7751
- Additional Names:
- F2|HuF2|TTF2|ZGRF6
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGEGEEKKADKKQREKGDQLFDQKKEQKPEMMEKDLSSGLVPKKKQSVVQEKKQEEGAEIQCEAETGGTHKRDFSEIKSQQCQGNELTRPSASSQEKSSGKSQDVQRESEPLREKVTQLLPQNVHSHN
- Uniprot:
- Q9UNY4
- Synonyms:
- F2;HuF2;human factor 2;lodestar homolog;lodestar protein;RNA polymerase II termination factor;transcription release factor 2;transcription termination factor 2;transcription termination factor, RNA polymerase II;ZGRF6;zinc finger, GRF-type containing 6
- Extra Details:
- This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing.
- Shipping Conditions:
- Blue Ice