ST8SIA2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7748
Additional Names:: HsT19690|SIAT8-B|SIAT8B|ST8SIA-II|ST8SIA2|ST8SiaII|STX
Application:: ELISA, WB
Molecular Weight:: 42kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIV
Uniprot:: Q92186
Synonyms:: alpha-2,8-sialyltransferase 8B;alpha-2,8-sialyltransferase 8B 1;HsT19690;sialyltransferase 8 (alpha-2, 8-sialytransferase) B;sialyltransferase 8B;sialyltransferase St8Sia II;sialyltransferase X;SIAT8-B;SIAT8B;ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 2;ST8SIA-II;ST8SiaII;STX
Extra Details:: The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.