TRPC3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7742
Additional Names:: SCA41|TRP3|TRPC3
Application:: ELISA, WB
Molecular Weight:: 96kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARD
Uniprot:: Q13507
Synonyms:: hTrp-3;SCA41;short transient receptor potential channel 3;transient receptor potential cation channel subfamily C member 3 variant c;transient receptor protein 3;TRP3
Extra Details:: The protein encoded by this gene is a membrane protein that can form a non-selective channel permeable to calcium and other cations. The encoded protein appears to be induced to form channels by a receptor tyrosine kinase-activated phosphatidylinositol second messenger system and also by depletion of intracellular calcium stores. Two transcript variants encoding different isoforms have been found for this gene.