A7738
Contactin 2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7738
- Additional Names:
- AXT|Contactin 2|FAME5|TAG-1|TAX|TAX1
- Application:
- ELISA, WB
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVEN
- Uniprot:
- Q02246
- Synonyms:
- axonal glycoprotein TAG-1;Axonin-1;axonin-1 cell adhesion molecule;AXT;contactin 2 (axonal);contactin 2 (transiently expressed);contactin-2;FAME5;TAG-1;TAX;TAX1;transient axonal glycoprotein 1
- Extra Details:
- This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy.
- Shipping Conditions:
- Blue Ice