A7729
SLC4A2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7729
- Additional Names:
- AE2|BND3L|EPB3L1|HKB3|NBND3|SLC4A2
- Application:
- ELISA, WB
- Molecular Weight:
- 140kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGSTQSGREGREPGPTPRARP
- Uniprot:
- P04920
- Synonyms:
- AE2;anion exchange protein 2;anion exchanger 2 type a;anion exchanger 2 type b1;anion exchanger 2 type b2;BND3L;EPB3L1;erythrocyte membrane protein band 3-like 1;HKB3;NBND3;non-erythroid band 3-like protein;solute carrier family 4 (anion exchanger), member 2;Solute carrier family 4 member 2
- Extra Details:
- This gene encodes a member of the anion exchanger family of membrane transport proteins. The encoded protein regulates intracellular pH, biliary bicarbonate secretion, and chloride uptake. Reduced expression of this gene may be associated with primary biliary cirrhosis (PBC) in human patients, while differential expression of this gene may be associated with malignant hepatocellular carcinoma, colon and gastric cancers.
- Shipping Conditions:
- Blue Ice

