A7723
SCN2B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7723
- Additional Names:
- ATFB14|SCN2B
- Application:
- ELISA, WB
- Molecular Weight:
- 24kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV
- Uniprot:
- O60939
- Synonyms:
- ATFB14;neuronal voltage-gated sodium channel beta 2 subunit;sodium channel subunit beta-2;sodium channel, voltage gated, type II beta subunit;sodium channel, voltage-gated, type II, beta polypeptide
- Extra Details:
- The protein encoded by this gene is the beta 2 subunit of the type II voltage-gated sodium channel. The encoded protein is involved in cell-cell adhesion and cell migration. Defects in this gene can be a cause of Brugada Syndrome, atrial fibrillation, or sudden infant death syndrome.
- Shipping Conditions:
- Blue Ice