A7706
P2RY1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7706
- Additional Names:
- P2RY1|P2Y1|SARCC
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
- Uniprot:
- P47900
- Synonyms:
- ADP receptor;ATP receptor;P2 purinoceptor subtype Y1;P2Y purinoceptor 1;P2Y1;platelet ADP receptor;Purinergic receptor;purinergic receptor P2Y, G-protein coupled, 1;SARCC;suppressing androgen receptor in renal cell carcinoma
- Extra Details:
- The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation.
- Shipping Conditions:
- Blue Ice