HSD17B3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7687
Additional Names:: EDH17B3|HSD17B3|SDR12C2
Application:: ELISA, WB
Molecular Weight:: 33kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
Uniprot:: P37058
Synonyms:: 17-beta-HSD 3;17-beta-HSD3;17-beta-hydroxysteroid dehydrogenase type 3;EDH17B3;estradiol 17-beta-dehydrogenase 2;hydroxysteroid dehydrogenase 3;SDR12C2;short chain dehydrogenase/reductase family 12C member 2;testicular 17-beta-hydroxysteroid dehydrogenase;testosterone 17-beta-dehydrogenase 3
Extra Details:: This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia.