A7685
HLA-DRB1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7685
- Additional Names:
- DRB1|HLA-DR1B|HLA-DRB|HLA-DRB1|SS1
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLS
- Uniprot:
- P01911, P01912, Q29974
- Synonyms:
- Clone P2-beta-3;DRB1;DW2.2/DR2.2;HLA class II histocompatibility antigen, DR-1 beta chain;HLA-DR1B;HLA-DRB;human leucocyte antigen DRB1;Human leukocyte antigen DRB1;lymphocyte antigen DRB1;major histocompatibility complex, class II, DR beta 1 precursor;MHC class II antigen DRB1*15;MHC class II antigen DRB1*16;MHC class II antigen DRB1*3;MHC class II HLA-DR beta 1 chain;SS1
- Extra Details:
- HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and some alleles have increased frequencies associated with certain diseases or conditions. For example, DRB1*1302 has been related to acute and chronic hepatitis B virus persistence. There are multiple pseudogenes of this gene.
- Shipping Conditions:
- Blue Ice

