A7682
GYPB Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7682
- Additional Names:
- CD235b|GPB|GYP|GYPA|GYPB|MNS|PAS-3|SS
- Application:
- ELISA, WB
- Molecular Weight:
- 25kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA
- Uniprot:
- P06028
- Synonyms:
- blood group system MNSs, Mur-like;blood group system MNSs, St(a) type E;blood group system MNSs, St(a) type F;CD235b;glycophorin A;glycophorin B blood group antigen;glycophorin B, blood group system Ss, S, Mit+;glycophorin B/glycophorin A fusion protein;glycophorin Hop;glycophorin-B;GPB;GYP;GYPA;GYPB-A fusion;GYPB-A-B fusion;GYPB/GYPA fusion;hybrid glycophorin Kip;MNS;PAS-3;sialoglycoprotein delta;SS;Ss blood group;SS-active sialoglycoprotein
- Extra Details:
- Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5' UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice