A7661
CSF3R Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7661
- Additional Names:
- CD114|CSF3R|GCSFR|SCN7
- Application:
- ELISA, WB
- Molecular Weight:
- 102kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CSPNRKNPLWPSVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDEKKPVPWESHNSSETCGLPTLVQTYVLQGDPRAVSTQPQSQSGTSDQV
- Uniprot:
- Q99062
- Synonyms:
- CD114;CD114 antigen;colony stimulating factor 3 receptor (granulocyte);G-CSF receptor;G-CSF-R;GCSFR;granulocyte colony-stimulating factor receptor;SCN7
- Extra Details:
- The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia.
- Shipping Conditions:
- Blue Ice