A7652
CEL Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7652
- Additional Names:
- BAL|BSDL|BSSL|CEase|CEL|CELL|FAP|FAPP|LIPA|MODY8
- Application:
- ELISA, WB
- Molecular Weight:
- 71kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYL
- Uniprot:
- P19835
- Synonyms:
- BAL;bile salt-activated lipase;Bile salt-stimulated lipase;BSDL;BSSL;bucelipase;carboxyl ester hydrolase;Carboxyl ester lipase;carboxyl ester lipase (bile salt-stimulated lipase);CEase;CELL;cholesterol esterase;FAP;FAPP;fetoacinar pancreatic protein;LIPA;lysophospholipase, pancreatic;MODY8;Pancreatic lysophospholipase;sterol esterase
- Extra Details:
- The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein.
- Shipping Conditions:
- Blue Ice

