CD30 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7651
Additional Names:: CD30|D1S166E|Ki-1
Application:: ELISA, WB
Molecular Weight:: 128kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Uniprot:: P28908
Synonyms:: CD30;CD30L receptor;cytokine receptor CD30;D1S166E;Ki-1;Ki-1 antigen;lymphocyte activation antigen CD30;tumor necrosis factor receptor superfamily member 8
Extra Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.