CACNB1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7649
Additional Names:: CAB1|CACNB1|CACNLB1|CCHLB1
Application:: ELISA, WB
Molecular Weight:: 66kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Uniprot:: Q02641
Synonyms:: CAB1;CACNLB1;calcium channel voltage-dependent subunit beta 1;calcium channel, L type, beta 1 polypeptide;calcium channel, voltage-dependent, beta 1 subunit;CCHLB1;dihydropyridine-sensitive L-type, calcium channel beta-1 subunit;voltage-dependent L-type calcium channel subunit beta-1
Extra Details:: The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.