UBIAD1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7640
Additional Names:: SCCD|TERE1|UBIAD1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPRLLVGCAVAVLAVHGAGNL
Uniprot:: Q9Y5Z9
Synonyms:: SCCD;TERE1;transitional epithelia response protein;transitional epithelial response protein 1;ubiA prenyltransferase domain-containing protein 1
Extra Details:: This gene encodes a protein thought to be involved in cholesterol and phospholipid metabolism. Mutations in this gene are associated with Schnyder crystalline corneal dystrophy.