A7639
YWHAZ Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A7639
- Additional Names:
- 14-3-3-zeta|HEL-S-3|HEL-S-93|HEL4|KCIP-1|POPCHAS|YWHAD|YWHAZ
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
- Uniprot:
- P63104
- Synonyms:
- 14-3-3 delta;14-3-3 protein zeta/delta;14-3-3 protein/cytosolic phospholipase A2;14-3-3 zeta;14-3-3-zeta;epididymis luminal protein 4;epididymis secretory protein Li 3;epididymis secretory protein Li 93;HEL-S-3;HEL-S-93;HEL4;KCIP-1;phospholipase A2;POPCHAS;Protein kinase C inhibitor protein 1;protein kinase C inhibitor protein-1;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide;YWHAD
- Extra Details:
- This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
- Shipping Conditions:
- Blue Ice





