GLUT4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7637
Additional Names:: GLUT4
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Uniprot:: P14672
Synonyms:: glucose transporter type 4, insulin-responsive;GLUT-4;GLUT4;insulin-responsive glucose transporter type 4;solute carrier family 2 (facilitated glucose transporter), member 4;solute carrier family 2, facilitated glucose transporter member 4
Extra Details:: This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM).