SPATA4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7608
Additional Names:: CFAP178|FAP178|SPATA4|SPEF1B|TSARG2
Application:: ELISA, WB
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQGLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLARKKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVSRSTVSKSIKDNIRLSELLSNPNMLTNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGEVTLNHLPAQA
Uniprot:: Q8NEY3
Synonyms:: CFAP178;FAP178;SPEF1B;spermatogenesis-associated protein 4;testis and spermatogenesis cell related protein 2;Testis and spermatogenesis cell-related protein 2;testis spermatocyte apoptosis-related gene 2 protein;TSARG2
Extra Details:: Predicted to enable microtubule binding activity. Predicted to be involved in regulation of cytoskeleton organization. Predicted to be located in cytoplasm. Predicted to be active in axoneme.