DIMT1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7589
Additional Names:: DIM1|DIMT1|DIMT1L|HSA9761|HUSSY5
Application:: ELISA, WB
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
Uniprot:: Q9UNQ2
Synonyms:: 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase;18S rRNA dimethylase;DIM1;DIM1 dimethyladenosine transferase 1 homolog;DIM1 dimethyladenosine transferase 1-like;dimethyladenosine transferase;DIMT1 rRNA methyltransferase and ribosome maturation factor;DIMT1L;HSA9761;HUSSY5;probable 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase;probable 18S rRNA dimethylase;probable dimethyladenosine transferase;probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase;S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase
Extra Details:: The protein encoded by this gene is a methyltransferase that is responsible for dimethylation of adjacent adenosines near the 18S rRNA decoding site. The encoded protein is essential for ribosome biogenesis, although its catalytic activity is not involved in the process. The yeast ortholog of this protein functions in the cytoplasm while this protein functions in the nucleus.

Shipping Conditions:: Blue Ice