Cytokeratin 6 (KRT6) Rabbit polyclonal antibody

Size

£152.00

SKU:: A7560
Additional Names:: CK-6C|CK-6E|CK6A|CK6C|CK6D|Cytokeratin 6 (KRT6)|K6A|K6C|K6D|KRT6C|KRT6D|PC3
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF
Uniprot:: P02538
Synonyms:: CK-6C;CK-6E;CK6A;CK6C;CK6D;cytokeratin 6A;cytokeratin 6C;cytokeratin 6D;Cytokeratin-6A;Cytokeratin-6D;K6A;K6C;K6D;keratin 6A, , type II;keratin 6A, type II;Keratin-6A;keratin, epidermal type II, K6A;keratin, type II cytoskeletal 6A;KRT6C;KRT6D;PC3;type-II keratin Kb6
Extra Details:: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. In addition, peptides from the C-terminal region of the protein have antimicrobial activity against bacterial pathogens. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Shipping Conditions:: Blue Ice