CRIP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7548
Additional Names:: CRHP|CRIP|CRIP1|CRP-1|CRP1
Application:: ELISA, WB
Molecular Weight:: 12 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Uniprot:: P50238
Synonyms:: CRHP;CRIP;CRP-1;CRP1;cysteine-rich heart protein;cysteine-rich intestinal protein;cysteine-rich protein 1;cysteine-rich protein 1 (intestinal)
Extra Details:: Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).