PPP3R2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7495
Additional Names:: PPP3R2|PPP3RL
Application:: ELISA, WB
Molecular Weight:: 16kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
Uniprot:: Q96LZ3
Synonyms:: calcineurin B-like protein;calcineurin B, type II (19kDa);calcineurin BII;calcineurin subunit B type 2;CBLP;CNBII;PPP3R1-like;PPP3RL;protein phosphatase 2B regulatory subunit 2;Protein phosphatase 3 regulatory subunit B beta isoform
Extra Details:: Predicted to enable calcium ion binding activity and calcium-dependent protein serine/threonine phosphatase regulator activity. Predicted to be involved in regulation of catalytic activity. Predicted to act upstream of or within penetration of zona pellucida. Predicted to be located in sperm mitochondrial sheath. Predicted to be part of calcineurin complex.