DNAJB9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7494
Additional Names:: DNAJB9|ERdj4|MDG-1|MDG1|MST049|MSTP049
Application:: ELISA, WB
Molecular Weight:: 25kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
Uniprot:: Q9UBS3
Synonyms:: DnaJ (Hsp40) homolog, subfamily B, member 9;dnaJ homolog subfamily B member 9;endoplasmic reticulum DNA J domain-containing protein 4;endoplasmic reticulum DnaJ homolog 4;ER-resident protein ERdj4;ERdj4;MDG-1;MDG1;microvascular endothelial differentiation gene 1 protein;MST049;MSTP049
Extra Details:: This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis.