Cytokeratin 16 (KRT16) Rabbit polyclonal antibody

Size

£152.00

SKU:: A7493
Additional Names:: CK16|Cytokeratin 16 (KRT16)|FNEPPK|K16|K1CP|KRT16A|NEPPK|PC1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 47kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQIEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKNRRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRLLEGEDAHLSS
Uniprot:: P08779
Synonyms:: CK16;cytokeratin 16;Cytokeratin-16;FNEPPK;focal non-epidermolytic palmoplantar keratoderma;K16;K1CP;keratin 16, type I;Keratin-16;keratin, type I cytoskeletal 16;KRT16A;NEPPK;PC1
Extra Details:: The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus.

Shipping Conditions:: Blue Ice