hnRNP A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7491
Additional Names:: ALS19|ALS20|hnRNP A1|hnRNP-A1|HNRPA1|HNRPA1L3|IBMPFD3|UP 1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 39kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
Uniprot:: P09651
Synonyms:: ALS19;ALS20;epididymis secretory sperm binding protein;helix-destabilizing protein;heterogeneous nuclear ribonucleoprotein A1;heterogeneous nuclear ribonucleoprotein A1B protein;heterogeneous nuclear ribonucleoprotein B2 protein;heterogeneous nuclear ribonucleoprotein core protein A1;hnRNP A1;hnRNP core protein A1;hnRNP core protein A1-like 3;hnRNP-A1;HNRPA1;HNRPA1L3;IBMPFD3;nuclear ribonucleoprotein particle A1 protein;putative heterogeneous nuclear ribonucleoprotein A1-like 3;single-strand DNA-binding protein UP1;single-strand RNA-binding protein;UP 1
Extra Details:: This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.

Shipping Conditions:: Blue Ice