CNDP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7485
Additional Names:: CN1|CNDP1|CPGL2|HsT2308
Application:: ELISA, WB
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALL
Uniprot:: Q96KN2
Synonyms:: beta-Ala-His dipeptidase;carnosinase 1;Carnosine dipeptidase 1;carnosine dipeptidase 1 (metallopeptidase M20 family);CN1;CNDP dipeptidase 1;CPGL2;glutamate carboxypeptidase-like protein 2;HsT2308;serum carnosinase
Extra Details:: This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region.