DAAM2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7463
Additional Names:: DAAM2|dJ90A20A.1|NPHS24
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 123kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKK
Uniprot:: Q86T65
Synonyms:: disheveled-associated activator of morphogenesis 2;dJ90A20A.1;NPHS24
Extra Details:: Predicted to enable actin binding activity and small GTPase binding activity. Predicted to be involved in nervous system development and regulation of Wnt signaling pathway. Predicted to act upstream of or within determination of left/right symmetry. Located in extracellular exosome.