SULT1E1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A7452
Additional Names:: EST|EST-1|ST1E1|STE|SULT1E1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI
Uniprot:: P49888
Synonyms:: EST;EST-1;estrogen sulfotransferase;estrone sulfotransferase;ST1E1;STE;sulfotransferase 1E1;sulfotransferase family 1E, estrogen-preferring, member 1;sulfotransferase, estrogen-preferring
Extra Details:: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.