A7436
HLX Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7436
- Additional Names:
- HB24|HLX|HLX1
- Application:
- ELISA, WB
- Molecular Weight:
- 51kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHHHHPQQQQQQQQPQQQQPPPPPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSR
- Uniprot:
- Q14774
- Synonyms:
- H2.0-like homeo box-1;H2.0-like homeobox 1;H2.0-like homeobox protein;HB24;HLX1;homeobox protein HB24;homeobox protein HLX1
- Extra Details:
- Enables sequence-specific DNA binding activity. Predicted to be involved in cell differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including animal organ development; enteric nervous system development; and regulation of T-helper cell differentiation. Predicted to be located in nucleus. Predicted to be part of chromatin.
- Shipping Conditions:
- Blue Ice