SUPT20H Rabbit polyclonal antibody

Size

£152.00

SKU:: A7374
Additional Names:: C13|C13orf19|FAM48A|FP757|P38IP|SPT20|SUPT20H
Application:: ELISA, WB, IHC-P
Molecular Weight:: 86kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMKRGTPTTPKF
Uniprot:: Q8NEM7
Synonyms:: C13;C13orf19;FAM48A;family with sequence similarity 48, member A;FP757;p38-interacting protein;P38IP;protein FAM48A;SPT20;suppressor of Ty 20 homolog;transcription factor (p38 interacting protein);transcription factor SPT20 homolog;tumor rejection antigen
Extra Details:: Predicted to enable transcription coregulator activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of gluconeogenesis and positive regulation of transcription by RNA polymerase II. Part of SAGA-type complex.