A7367
MOCS3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7367
- Additional Names:
- MOCS3|UBA4
- Application:
- ELISA, WB
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
- Uniprot:
- O95396
- Synonyms:
- adenylyltransferase and sulfurtransferase MOCS3;molybdenum cofactor synthesis protein 3;molybdopterin synthase sulfurylase;MPT synthase sulfurylase;UBA4;UBA4, ubiquitin-activating enzyme E1 homolog;ubiquitin-like modifier activating enzyme 4
- Extra Details:
- Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14.
- Shipping Conditions:
- Blue Ice