A7344
UBE2H Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A7344
- Additional Names:
- E2-20K|GID3|UBC8|UBCH|UBCH2|UBE2H
- Application:
- ELISA, WB
- Molecular Weight:
- 21-42kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
- Uniprot:
- P62256
- Synonyms:
- (E3-independent) E2 ubiquitin-conjugating enzyme H;E2 ubiquitin-conjugating enzyme H;E2-20K;GID complex subunit 3, UBC8 homolog;GID3;UBC8;UBCH;UBCH2;ubiquitin carrier protein H;ubiquitin conjugating enzyme E2H;ubiquitin-conjugating enzyme E2 H;ubiquitin-conjugating enzyme E2-20K;ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8);ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast);ubiquitin-protein ligase H
- Extra Details:
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.
- Shipping Conditions:
- Blue Ice